Total number of results for Elephas maximus are 2
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02654 |
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
30 | Elephas maximus | Insulin | Insulin B chain | 5949593#Smith L.F.#Species variation in the amino acid sequence of insulin.# Am. J. Med. 40:662-666(1966). | |
| NP02655 |
GIVEQCCTGVCSLYQLENYCN
|
21 | Elephas maximus | Insulin | Insulin A chain | 5949593#Smith L.F.#Species variation in the amino acid sequence of insulin.# Am. J. Med. 40:662-666(1966). |